Lineage for d4b6la_ (4b6l A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (31 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1194 PDB entries)
  8. 2546555Domain d4b6la_: 4b6l A: [234125]
    automated match to d4i5pa_
    complexed with 9zp, so4

Details for d4b6la_

PDB Entry: 4b6l (more details), 1.9 Å

PDB Description: Discovery of Oral Polo-Like Kinase (PLK) Inhibitors with Enhanced Selectivity Profile using Residue Targeted Drug Design
PDB Compounds: (A:) serine/threonine-protein kinase plk3

SCOPe Domain Sequences for d4b6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6la_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
litdprsgrtylkgrllgkggfarcyeatdtetgsayavkvipqsrvakphqrekilnei
elhrdlqhrhivrfshhfedadniyiflelcsrkslahiwkarhtllepevryylrqils
glkylhqrgilhrdlklgnffitenmelkvgdfglaarleppeqrkkticgtpnyvapev
llrqghgpeadvwslgcvmytllcgsppfetadlketyrcikqvhytlpaslslparqll
aailrasprdrpsidqilrhdfftkgytpdrlpisscvtvp

SCOPe Domain Coordinates for d4b6la_:

Click to download the PDB-style file with coordinates for d4b6la_.
(The format of our PDB-style files is described here.)

Timeline for d4b6la_: