SCOPe 2.08: Domain d4b4da2: 4b4d A:102-259

Lineage for d4b4da2 (4b4d A:102-259)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [234121] (1 PDB entry)

8. Domain d4b4da2: 4b4d A:102-259 [234122]
   Other proteins in same PDB: d4b4da1
   automated match to d1a8pa2
   complexed with cl, fad

Details for d4b4da2

PDB Entry: 4b4d, 1.5 Å

PDB Description: Crystal structure of FAD-containing ferredoxin-NADP reductase from Xanthomonas axonopodis pv. citri

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d4b4da2:

Sequence; same for both SEQRES and ATOM records:

>d4b4da2 c.25.1.0 (A:102-259) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
isdlhpgrnlyllgtgtglapwlsiikdpetyerfdkviltqgvrfvqdlayrdyferel
pqheflgdllrekllyypavtretfanqgrltelmadgrmqqtlglptldpandrfmicg
spqmladlrslldsrgfqtsprigtpghyvferafvek

Timeline for d4b4da2:

• d4b4da2 first appeared in SCOPe 2.03
  
• d4b4da2 appears in SCOPe 2.07