SCOPe 2.08: Domain d4b4da1: 4b4d A:4-101

Lineage for d4b4da1 (4b4d A:4-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [234119] (1 PDB entry)

8. Domain d4b4da1: 4b4d A:4-101 [234120]
   Other proteins in same PDB: d4b4da2
   automated match to d1a8pa1
   complexed with cl, fad

Details for d4b4da1

PDB Entry: 4b4d, 1.5 Å

PDB Description: Crystal structure of FAD-containing ferredoxin-NADP reductase from Xanthomonas axonopodis pv. citri

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d4b4da1:

Sequence; same for both SEQRES and ATOM records:

>d4b4da1 b.43.4.0 (A:4-101) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
afgaetvlevrhwtdayfsftttrdagfrfengqfvmigletetrpllraysiasanwee
hleffsikvpdgpltsrlqhiqpgdkvlvgkkptgtll

Timeline for d4b4da1:

• d4b4da1 first appeared in SCOPe 2.03
  
• d4b4da1 appears in SCOPe 2.07