Lineage for d1pov1_ (1pov 1:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2086605Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2086661Protein Poliovirus coat proteins [49666] (3 species)
  7. 2086662Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (12 PDB entries)
  8. 2086694Domain d1pov1_: 1pov 1: [23412]
    contains unprocessed VP0
    complexed with myr, sph

Details for d1pov1_

PDB Entry: 1pov (more details), 2.8 Å

PDB Description: role and mechanism of the maturation cleavage of vp0 in poliovirus assembly: structure of the empty capsid assembly intermediate at 2.9 angstroms resolution
PDB Compounds: (1:) poliovirus native empty capsid (type 1)

SCOPe Domain Sequences for d1pov1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pov1_ b.121.4.1 (1:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
qhrsrsessiesffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrkleffty
srfdmeltfvvtanftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifyty
gtaparisvpyvgisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvnd
hnptkvtskirvylkpkhirvwcprppravayygpgvdykdgtltplstkdltty

SCOPe Domain Coordinates for d1pov1_:

Click to download the PDB-style file with coordinates for d1pov1_.
(The format of our PDB-style files is described here.)

Timeline for d1pov1_: