SCOP 1.59: Domain d1pov1_: 1pov 1:

Lineage for d1pov1_ (1pov 1:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (16 proteins)

6. Protein Poliovirus [49666] (3 species)

7. Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (11 PDB entries)

8. Domain d1pov1_: 1pov 1: [23412]

Details for d1pov1_

PDB Entry: 1pov, 2.88 Å

PDB Description: role and mechanism of the maturation cleavage of vp0 in poliovirus assembly: structure of the empty capsid assembly intermediate at 2.9 angstroms resolution

SCOP Domain Sequences for d1pov1_:

Sequence; same for both SEQRES and ATOM records:

>d1pov1_ b.10.1.4 (1:) Poliovirus {Poliovirus type 1, strain Mahoney}
qhrsrsessiesffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrkleffty
srfdmeltfvvtanftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifyty
gtaparisvpyvgisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvnd
hnptkvtskirvylkpkhirvwcprppravayygpgvdykdgtltplstkdltty

Timeline for d1pov1_:

• d1pov1_ first appeared (with stable ids) in SCOP 1.55
  
• d1pov1_ appears in SCOP 1.57
  
• d1pov1_ appears in SCOP 1.61
  
• d1pov1_ appears in the current release, SCOPe 2.08