Lineage for d4b1yb1 (4b1y B:1-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885506Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (13 PDB entries)
  8. 2885507Domain d4b1yb1: 4b1y B:1-146 [234117]
    Other proteins in same PDB: d4b1yb2
    automated match to d2btfa1
    complexed with 1pe, atp, gol, lab, mg, p6g, peg

Details for d4b1yb1

PDB Entry: 4b1y (more details), 1.29 Å

PDB Description: structure of the phactr1 rpel-3 bound to g-actin
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4b1yb1:

Sequence, based on SEQRES records: (download)

>d4b1yb1 c.55.1.0 (B:1-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
krgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt
qimfetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d4b1yb1 c.55.1.0 (B:1-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dedettalvcdngsglvkagfagddapravfpsivgrprhsyvgdeaqskrgiltlkypi
ehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpa
myvaiqavlslyasg

SCOPe Domain Coordinates for d4b1yb1:

Click to download the PDB-style file with coordinates for d4b1yb1.
(The format of our PDB-style files is described here.)

Timeline for d4b1yb1: