Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (13 PDB entries) |
Domain d4b1yb1: 4b1y B:1-146 [234117] Other proteins in same PDB: d4b1yb2 automated match to d2btfa1 complexed with 1pe, atp, gol, lab, mg, p6g, peg |
PDB Entry: 4b1y (more details), 1.29 Å
SCOPe Domain Sequences for d4b1yb1:
Sequence, based on SEQRES records: (download)
>d4b1yb1 c.55.1.0 (B:1-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} dedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs krgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmt qimfetfnvpamyvaiqavlslyasg
>d4b1yb1 c.55.1.0 (B:1-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} dedettalvcdngsglvkagfagddapravfpsivgrprhsyvgdeaqskrgiltlkypi ehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpa myvaiqavlslyasg
Timeline for d4b1yb1: