SCOPe 2.07: Domain d4az8a1: 4az8 A:9-147

Lineage for d4az8a1 (4az8 A:9-147)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein automated matches [227064] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [234112] (2 PDB entries)

8. Domain d4az8a1: 4az8 A:9-147 [234115]
   Other proteins in same PDB: d4az8a2, d4az8b_
   automated match to d3dosa1

Details for d4az8a1

PDB Entry: 4az8, 2.65 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the kdkdtn insertion at the f1g1 loop region

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4az8a1:

Sequence, based on SEQRES records:

>d4az8a1 b.1.11.1 (A:9-147) automated matches {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdkdt
ndvgvfvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d4az8a1 b.1.11.1 (A:9-147) automated matches {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydfvvtpplfrldakqqnsl
riaqfprdkeslkwlcvkgippvgvfvqfainncikllvrpnel

Timeline for d4az8a1:

• d4az8a1 first appeared in SCOPe 2.03
  
• d4az8a1 appears in SCOPe 2.06
  
• d4az8a1 appears in the current release, SCOPe 2.08