SCOPe 2.08: Domain d4ayfa2: 4ayf A:148-233

Lineage for d4ayfa2 (4ayf A:148-233)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.0: automated matches [227280] (1 protein)
   not a true family

6. Protein automated matches [227091] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226477] (3 PDB entries)

8. Domain d4ayfa2: 4ayf A:148-233 [234114]
   Other proteins in same PDB: d4ayfa1, d4ayfb_
   automated match to d3dosa2
   mutant

Details for d4ayfa2

PDB Entry: 4ayf, 2.07 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone

PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4ayfa2:

Sequence, based on SEQRES records:

>d4ayfa2 b.7.2.0 (A:148-233) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknv

Sequence, based on observed residues (ATOM records):

>d4ayfa2 b.7.2.0 (A:148-233) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdgkliaenpspfymnigeltfggsipshyippkstwafdlpgarn
vswriindqggldrlysknv

Timeline for d4ayfa2:

• d4ayfa2 first appeared in SCOPe 2.03
  
• d4ayfa2 appears in SCOPe 2.07