Lineage for d4ayfa2 (4ayf A:148-233)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773237Family b.7.2.0: automated matches [227280] (1 protein)
    not a true family
  6. 2773238Protein automated matches [227091] (2 species)
    not a true protein
  7. 2773250Species Yersinia pestis [TaxId:632] [226477] (3 PDB entries)
  8. 2773253Domain d4ayfa2: 4ayf A:148-233 [234114]
    Other proteins in same PDB: d4ayfa1, d4ayfb_
    automated match to d3dosa2
    mutant

Details for d4ayfa2

PDB Entry: 4ayf (more details), 2.07 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4ayfa2:

Sequence, based on SEQRES records: (download)

>d4ayfa2 b.7.2.0 (A:148-233) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknv

Sequence, based on observed residues (ATOM records): (download)

>d4ayfa2 b.7.2.0 (A:148-233) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdgkliaenpspfymnigeltfggsipshyippkstwafdlpgarn
vswriindqggldrlysknv

SCOPe Domain Coordinates for d4ayfa2:

Click to download the PDB-style file with coordinates for d4ayfa2.
(The format of our PDB-style files is described here.)

Timeline for d4ayfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ayfa1
View in 3D
Domains from other chains:
(mouse over for more information)
d4ayfb_