Lineage for d4ayfa1 (4ayf A:9-147)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523399Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 1523400Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 1523481Protein automated matches [227064] (2 species)
    not a true protein
  7. 1523485Species Yersinia pestis [TaxId:632] [234112] (2 PDB entries)
  8. 1523486Domain d4ayfa1: 4ayf A:9-147 [234113]
    Other proteins in same PDB: d4ayfa2, d4ayfb_
    automated match to d3dosa1
    mutant

Details for d4ayfa1

PDB Entry: 4ayf (more details), 2.07 Å

PDB Description: crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone
PDB Compounds: (A:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4ayfa1:

Sequence, based on SEQRES records: (download)

>d4ayfa1 b.1.11.1 (A:9-147) automated matches {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdapvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d4ayfa1 b.1.11.1 (A:9-147) automated matches {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdapvliqsriydepfvvtpplfrldakqqn
slriaqfprdkeslkwlcvkgippvgvfvqfainncikllvrpnel

SCOPe Domain Coordinates for d4ayfa1:

Click to download the PDB-style file with coordinates for d4ayfa1.
(The format of our PDB-style files is described here.)

Timeline for d4ayfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ayfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d4ayfb_