| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
| Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
| Protein automated matches [227064] (2 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [234112] (2 PDB entries) |
| Domain d4ayfa1: 4ayf A:9-147 [234113] Other proteins in same PDB: d4ayfa2, d4ayfb_ automated match to d3dosa1 mutant |
PDB Entry: 4ayf (more details), 2.07 Å
SCOPe Domain Sequences for d4ayfa1:
Sequence, based on SEQRES records: (download)
>d4ayfa1 b.1.11.1 (A:9-147) automated matches {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdapvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel
>d4ayfa1 b.1.11.1 (A:9-147) automated matches {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdapvliqsriydepfvvtpplfrldakqqn
slriaqfprdkeslkwlcvkgippvgvfvqfainncikllvrpnel
Timeline for d4ayfa1: