Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Poliovirus coat proteins [49666] (3 species) |
Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (12 PDB entries) |
Domain d1pov0_: 1pov 0: [23411] contains unprocessed VP0 complexed with myr, sph |
PDB Entry: 1pov (more details), 2.8 Å
SCOPe Domain Sequences for d1pov0_:
Sequence, based on SEQRES records: (download)
>d1pov0_ b.121.4.1 (0:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]} gaqvssqkvgahensnrayggstinyttinyyrdsasnaaskqdfsqdpskftepikdvl iktapmlnspnieacgysdrvlqltlgnstittqeaansvvaygrwpeylrdseanpvdq ptepdvaacrfytldtvswtkesrgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqc naskfhqgalgvfavpemclagdsntttmhtsyqnanpgekggtftgtftpdnnqtspar rfcpvdyllgngtllgnafvfphqiinlrtnncatlvlpyvnslsidsmvkhnnwgiail plaplnfasesspeipitltiapmccefnglrnitlprlq
>d1pov0_ b.121.4.1 (0:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]} gaqvssqkvgahinyttinyyrdsasnaaskqikdvliktapmlnspnieacgylqltlg nstittqeaansvvaygrwpeylrdvaacrfytldtvswtkesrgwwwklpdalrdmglf gqnmyyhylgrsgytvhvqcnaskfhqgalgvfavpemclagdsntttmhtsyqnanpge kggtftgtftpdnnqtsparrfcpvdyllgngtllgnafvfphqiinlrtnncatlvlpy vnslsidsmvkhnnwgiailplaplnfasesspeipitltiapmccefnglrnitlprlq
Timeline for d1pov0_: