Lineage for d1pov0_ (1pov 0:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2821779Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2821837Protein Poliovirus coat proteins [49666] (3 species)
  7. 2821838Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (13 PDB entries)
  8. 2821843Domain d1pov0_: 1pov 0: [23411]
    contains unprocessed VP0
    complexed with myr, sph

Details for d1pov0_

PDB Entry: 1pov (more details), 2.8 Å

PDB Description: role and mechanism of the maturation cleavage of vp0 in poliovirus assembly: structure of the empty capsid assembly intermediate at 2.9 angstroms resolution
PDB Compounds: (0:) poliovirus native empty capsid (type 1)

SCOPe Domain Sequences for d1pov0_:

Sequence, based on SEQRES records: (download)

>d1pov0_ b.121.4.1 (0:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
gaqvssqkvgahensnrayggstinyttinyyrdsasnaaskqdfsqdpskftepikdvl
iktapmlnspnieacgysdrvlqltlgnstittqeaansvvaygrwpeylrdseanpvdq
ptepdvaacrfytldtvswtkesrgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqc
naskfhqgalgvfavpemclagdsntttmhtsyqnanpgekggtftgtftpdnnqtspar
rfcpvdyllgngtllgnafvfphqiinlrtnncatlvlpyvnslsidsmvkhnnwgiail
plaplnfasesspeipitltiapmccefnglrnitlprlq

Sequence, based on observed residues (ATOM records): (download)

>d1pov0_ b.121.4.1 (0:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
gaqvssqkvgahinyttinyyrdsasnaaskqikdvliktapmlnspnieacgylqltlg
nstittqeaansvvaygrwpeylrdvaacrfytldtvswtkesrgwwwklpdalrdmglf
gqnmyyhylgrsgytvhvqcnaskfhqgalgvfavpemclagdsntttmhtsyqnanpge
kggtftgtftpdnnqtsparrfcpvdyllgngtllgnafvfphqiinlrtnncatlvlpy
vnslsidsmvkhnnwgiailplaplnfasesspeipitltiapmccefnglrnitlprlq

SCOPe Domain Coordinates for d1pov0_:

Click to download the PDB-style file with coordinates for d1pov0_.
(The format of our PDB-style files is described here.)

Timeline for d1pov0_: