Lineage for d4aw4c1 (4aw4 C:36-262)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460208Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2460209Protein automated matches [190787] (14 species)
    not a true protein
  7. 2460279Species Listeria monocytogenes [TaxId:169963] [228586] (2 PDB entries)
  8. 2460282Domain d4aw4c1: 4aw4 C:36-262 [234105]
    Other proteins in same PDB: d4aw4a2, d4aw4b2
    automated match to d1h6ua2
    complexed with gol, so4

Details for d4aw4c1

PDB Entry: 4aw4 (more details), 1.93 Å

PDB Description: engineered variant of listeria monocytogenes inlb internalin domain with an additional leucine rich repeat inserted
PDB Compounds: (C:) internalin b

SCOPe Domain Sequences for d4aw4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aw4c1 c.10.2.0 (C:36-262) automated matches {Listeria monocytogenes [TaxId: 169963]}
etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlfldenkvk
dlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlsl
ednqisdivplagltklqnlylsknhisdlralaglknldvlelfsq

SCOPe Domain Coordinates for d4aw4c1:

Click to download the PDB-style file with coordinates for d4aw4c1.
(The format of our PDB-style files is described here.)

Timeline for d4aw4c1: