Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (39 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries) |
Domain d4aw4b2: 4aw4 B:263-342 [234104] Other proteins in same PDB: d4aw4a1, d4aw4b1, d4aw4c1 automated match to d1h6ua1 complexed with gol, so4 |
PDB Entry: 4aw4 (more details), 1.93 Å
SCOPe Domain Sequences for d4aw4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aw4b2 b.1.18.0 (B:263-342) automated matches {Listeria monocytogenes [TaxId: 169963]} eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq pvtigkakarfhgrvtqplk
Timeline for d4aw4b2: