Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (7 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [228586] (2 PDB entries) |
Domain d4aw4b1: 4aw4 B:36-262 [234103] Other proteins in same PDB: d4aw4a2, d4aw4b2 automated match to d1h6ua2 complexed with gol, so4 |
PDB Entry: 4aw4 (more details), 1.93 Å
SCOPe Domain Sequences for d4aw4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aw4b1 c.10.2.0 (B:36-262) automated matches {Listeria monocytogenes [TaxId: 169963]} etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq ylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlfldenkvk dlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlsl ednqisdivplagltklqnlylsknhisdlralaglknldvlelfsq
Timeline for d4aw4b1: