Lineage for d4aw4b1 (4aw4 B:36-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851993Species Listeria monocytogenes [TaxId:169963] [228586] (2 PDB entries)
  8. 2851995Domain d4aw4b1: 4aw4 B:36-262 [234103]
    Other proteins in same PDB: d4aw4a2, d4aw4b2
    automated match to d1h6ua2
    complexed with gol, so4

Details for d4aw4b1

PDB Entry: 4aw4 (more details), 1.93 Å

PDB Description: engineered variant of listeria monocytogenes inlb internalin domain with an additional leucine rich repeat inserted
PDB Compounds: (B:) internalin b

SCOPe Domain Sequences for d4aw4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aw4b1 c.10.2.0 (B:36-262) automated matches {Listeria monocytogenes [TaxId: 169963]}
etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlfldenkvk
dlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlsl
ednqisdivplagltklqnlylsknhisdlralaglknldvlelfsq

SCOPe Domain Coordinates for d4aw4b1:

Click to download the PDB-style file with coordinates for d4aw4b1.
(The format of our PDB-style files is described here.)

Timeline for d4aw4b1: