Lineage for d4aw4a2 (4aw4 A:263-342)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771214Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)
  8. 1771215Domain d4aw4a2: 4aw4 A:263-342 [234102]
    Other proteins in same PDB: d4aw4a1, d4aw4b1, d4aw4c1
    automated match to d1h6ua1
    complexed with gol, so4

Details for d4aw4a2

PDB Entry: 4aw4 (more details), 1.93 Å

PDB Description: engineered variant of listeria monocytogenes inlb internalin domain with an additional leucine rich repeat inserted
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d4aw4a2:

Sequence, based on SEQRES records: (download)

>d4aw4a2 b.1.18.0 (A:263-342) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplk

Sequence, based on observed residues (ATOM records): (download)

>d4aw4a2 b.1.18.0 (A:263-342) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwnevsfifyqpvtigk
akarfhgrvtqplk

SCOPe Domain Coordinates for d4aw4a2:

Click to download the PDB-style file with coordinates for d4aw4a2.
(The format of our PDB-style files is described here.)

Timeline for d4aw4a2: