SCOPe 2.03: Domain d4aw4a1: 4aw4 A:36-262

Lineage for d4aw4a1 (4aw4 A:36-262)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (6 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [228586] (2 PDB entries)

8. Domain d4aw4a1: 4aw4 A:36-262 [234101]
   Other proteins in same PDB: d4aw4a2, d4aw4b2
   automated match to d1h6ua2
   complexed with gol, so4

Details for d4aw4a1

PDB Entry: 4aw4, 1.93 Å

PDB Description: engineered variant of listeria monocytogenes inlb internalin domain with an additional leucine rich repeat inserted

PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d4aw4a1:

Sequence; same for both SEQRES and ATOM records:

>d4aw4a1 c.10.2.0 (A:36-262) automated matches {Listeria monocytogenes [TaxId: 169963]}
etitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnltslnlsnnqitdispiqylpnvtklflngnkltdikplanlknlgwlfldenkvk
dlsslkdlkklkslslehngisdinglvhlpqleslylgnnkitditvlsrltkldtlsl
ednqisdivplagltklqnlylsknhisdlralaglknldvlelfsq

Timeline for d4aw4a1:

• d4aw4a1 is new in SCOPe 2.03-stable
  
• d4aw4a1 appears in SCOPe 2.04
  
• d4aw4a1 appears in the current release, SCOPe 2.08