SCOPe 2.03: Domain d4av4a_: 4av4 A:

Lineage for d4av4a_ (4av4 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein automated matches [190569] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:364106] [234099] (1 PDB entry)

8. Domain d4av4a_: 4av4 A: [234100]
   automated match to d4av5a_
   complexed with fvq

Details for d4av4a_

PDB Entry: 4av4, 1.9 Å

PDB Description: fimh lectin domain co-crystal with a alpha-d-mannoside o-linked to a propynyl pyridine

PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d4av4a_:

Sequence; same for both SEQRES and ATOM records:

>d4av4a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 364106]}
facktangtaipigggsanvyvnlapvvnvgqnlvvnlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4av4a_:

• d4av4a_ is new in SCOPe 2.03-stable
  
• d4av4a_ appears in SCOPe 2.04
  
• d4av4a_ appears in the current release, SCOPe 2.08