SCOPe 2.08: Domain d4atma_: 4atm A:

Lineage for d4atma_ (4atm A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.0: automated matches [191660] (1 protein)
   not a true family

6. Protein automated matches [191240] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries)

8. Domain d4atma_: 4atm A: [234094]
   automated match to d4avma_
   complexed with edo, gol

Details for d4atma_

PDB Entry: 4atm, 1.78 Å

PDB Description: Crystal structure of the BAR domain of human Amphiphysin, isoform 1 at 1.8 Angstrom resolution featuring increased order at the N- terminus.

PDB Compounds: (A:) amphiphysin

SCOPe Domain Sequences for d4atma_:

Sequence; same for both SEQRES and ATOM records:

>d4atma_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raqekvlqklgkadetkdeqfeeyvqnfkrqeaegtrlqrelrgylaaikgmqeasmklt
eslhevyepdwygredvkmvgekcdvlwedfhqklvdeslltldtylgqfpdiknriakr
srklvdydsarhhlealqsskrkdesriskaeeefqkaqkvfeefnvdlqeelpslwsrr
vgfyvntfknvssleakfhkeiavlchklyevmtklgdqha

Timeline for d4atma_:

• d4atma_ first appeared in SCOPe 2.03
  
• d4atma_ appears in SCOPe 2.07