![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
![]() | Protein automated matches [191087] (19 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries) |
![]() | Domain d4anee_: 4ane E: [234082] automated match to d3fc9a_ complexed with cit; mutant |
PDB Entry: 4ane (more details), 1.9 Å
SCOPe Domain Sequences for d4anee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4anee_ d.58.6.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs llefitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds aesaqreialwfpga
Timeline for d4anee_: