Lineage for d4anec_ (4ane C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951800Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries)
  8. 2951803Domain d4anec_: 4ane C: [234081]
    automated match to d3fc9a_
    complexed with cit; mutant

Details for d4anec_

PDB Entry: 4ane (more details), 1.9 Å

PDB Description: r80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4anec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anec_ d.58.6.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

SCOPe Domain Coordinates for d4anec_:

Click to download the PDB-style file with coordinates for d4anec_.
(The format of our PDB-style files is described here.)

Timeline for d4anec_: