Lineage for d4aned_ (4ane D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194897Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2194898Protein automated matches [191087] (14 species)
    not a true protein
  7. 2195000Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries)
  8. 2195004Domain d4aned_: 4ane D: [234080]
    automated match to d3fc9a_
    complexed with cit; mutant

Details for d4aned_

PDB Entry: 4ane (more details), 1.9 Å

PDB Description: r80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4aned_:

Sequence, based on SEQRES records: (download)

>d4aned_ d.58.6.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

Sequence, based on observed residues (ATOM records): (download)

>d4aned_ d.58.6.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehefgsllef
itsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaesa
qreialwfpga

SCOPe Domain Coordinates for d4aned_:

Click to download the PDB-style file with coordinates for d4aned_.
(The format of our PDB-style files is described here.)

Timeline for d4aned_: