Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (7 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries) |
Domain d4aneb_: 4ane B: [234078] automated match to d3fc9a_ complexed with cit; mutant |
PDB Entry: 4ane (more details), 1.9 Å
SCOPe Domain Sequences for d4aneb_:
Sequence, based on SEQRES records: (download)
>d4aneb_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs llefitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds aesaqreialwfpga
>d4aneb_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegfgslle fitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaes aqreialwfpga
Timeline for d4aneb_: