SCOPe 2.08: Domain d4aneb_: 4ane B:

Lineage for d4aneb_ (4ane B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries)

8. Domain d4aneb_: 4ane B: [234078]
   automated match to d3fc9a_
   complexed with cit; mutant

Details for d4aneb_

PDB Entry: 4ane, 1.9 Å

PDB Description: r80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4aneb_:

Sequence, based on SEQRES records:

>d4aneb_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

Sequence, based on observed residues (ATOM records):

>d4aneb_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegfgslle
fitsgpvvaaivegtnaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaes
aqreialwfpga

Timeline for d4aneb_:

• d4aneb_ first appeared in SCOPe 2.03
  
• d4aneb_ appears in SCOPe 2.07