Lineage for d4anda_ (4and A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951800Species Mycobacterium tuberculosis [TaxId:1773] [234075] (3 PDB entries)
  8. 2951808Domain d4anda_: 4and A: [234077]
    automated match to d3fc9a_
    mutant

Details for d4anda_

PDB Entry: 4and (more details), 2.81 Å

PDB Description: crystal form ii of the d93n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4anda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4anda_ d.58.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtraiaavrqlaggtnpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

SCOPe Domain Coordinates for d4anda_:

Click to download the PDB-style file with coordinates for d4anda_.
(The format of our PDB-style files is described here.)

Timeline for d4anda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4andb_