Lineage for d4amta_ (4amt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061062Species Human (Homo sapiens) [TaxId:9606] [193159] (12 PDB entries)
  8. 2061080Domain d4amta_: 4amt A: [234074]
    automated match to d3psga_
    complexed with so4

Details for d4amta_

PDB Entry: 4amt (more details), 2.6 Å

PDB Description: The crystal structure at 2.6A of human prorenin
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d4amta_:

Sequence, based on SEQRES records: (download)

>d4amta_ b.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttfkriflkrmpsireslkergvdmarlgpewsqpmkrltlgnttssviltnymdtqyyg
eigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklfdasdsssykhngteltlr
ystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaefdgvvgmgfieqaigrvtp
ifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpqhyegnfhyinliktgvwq
iqmkgvsvgsstllcedgclalvdtgasyisgstssieklmealgakkrlfdyvvkcneg
ptlpdisfhlggkeytltsadyvfqesysskklctlaihamdippptgptwalgatfirk
fytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d4amta_ b.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttfkriflkrmpsireslkergvdmarlgpeiltnymdtqyygeigigtppqtfkvvfdt
gssnvwvpsskcsrlytacvyhklfdasdsssykhngteltlrystgtvsgflsqdiitv
ggitvtqmfgevtempalpfmlaefdgvvgmgfieqaigrvtpifdniisqgvlkedvfs
fyynrdlggqivlggsdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalv
dtgasyisgstssieklmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyv
fkklctlaihamdippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d4amta_:

Click to download the PDB-style file with coordinates for d4amta_.
(The format of our PDB-style files is described here.)

Timeline for d4amta_: