![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
![]() | Protein automated matches [226884] (9 species) not a true protein |
![]() | Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227655] (3 PDB entries) |
![]() | Domain d4am1a1: 4am1 A:2-95 [234072] Other proteins in same PDB: d4am1a2, d4am1a3 automated match to d1m15a1 |
PDB Entry: 4am1 (more details), 1.25 Å
SCOPe Domain Sequences for d4am1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4am1a1 a.83.1.0 (A:2-95) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]} adaaviekleagfkkleaatdcksllkkyltkevfdklkdkktslgatlldviqsgvenl dsgvgiyapdaeaytlfaplfdpiiedyhvgfkq
Timeline for d4am1a1: