SCOPe 2.06: Domain d4ajda1: 4ajd A:449-770

Lineage for d4ajda1 (4ajd A:449-770)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d4ajda1: 4ajd A:449-770 [234071]
   Other proteins in same PDB: d4ajda2, d4ajdd2
   automated match to d3wi2a_
   complexed with f04, mg, zn

Details for d4ajda1

PDB Entry: 4ajd, 2.3 Å

PDB Description: identification and structural characterization of pde10 fragment inhibitors

PDB Compounds: (A:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a, pde10

SCOPe Domain Sequences for d4ajda1:

Sequence; same for both SEQRES and ATOM records:

>d4ajda1 a.211.1.0 (A:449-770) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgee

Timeline for d4ajda1:

• d4ajda1 first appeared in SCOPe 2.03, called d4ajda_
  
• d4ajda1 was called d4ajda_ in SCOPe 2.05
  
• d4ajda1 appears in SCOPe 2.07
  
• d4ajda1 appears in the current release, SCOPe 2.08