Lineage for d4ajda_ (4ajd A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1286061Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1286062Protein automated matches [190983] (4 species)
    not a true protein
  7. 1286063Species Human (Homo sapiens) [TaxId:9606] [188676] (34 PDB entries)
  8. 1286108Domain d4ajda_: 4ajd A: [234071]
    automated match to d3wi2a_
    complexed with f04, mg, zn

Details for d4ajda_

PDB Entry: 4ajd (more details), 2.3 Å

PDB Description: identification and structural characterization of pde10 fragment inhibitors
PDB Compounds: (A:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a, pde10

SCOPe Domain Sequences for d4ajda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajda_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nasictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvirgee

SCOPe Domain Coordinates for d4ajda_:

Click to download the PDB-style file with coordinates for d4ajda_.
(The format of our PDB-style files is described here.)

Timeline for d4ajda_: