| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries) |
| Domain d4ag3a1: 4ag3 A:1-247 [234067] Other proteins in same PDB: d4ag3a2, d4ag3c2 automated match to d4afna_ complexed with 1pe, ndp |
PDB Entry: 4ag3 (more details), 1.8 Å
SCOPe Domain Sequences for d4ag3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ag3a1 c.2.1.0 (A:1-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnlnslyrl
skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
nggmyms
Timeline for d4ag3a1:
View in 3DDomains from other chains: (mouse over for more information) d4ag3b_, d4ag3c1, d4ag3c2, d4ag3d_ |