Lineage for d4ag3a1 (4ag3 A:1-247)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848075Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196452] (30 PDB entries)
  8. 2848082Domain d4ag3a1: 4ag3 A:1-247 [234067]
    Other proteins in same PDB: d4ag3a2, d4ag3c2
    automated match to d4afna_
    complexed with 1pe, ndp

Details for d4ag3a1

PDB Entry: 4ag3 (more details), 1.8 Å

PDB Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (FabG) from Pseudomonas aeruginosa in complex with NADPH at 1.8A resolution
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4ag3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ag3a1 c.2.1.0 (A:1-247) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mslqgkvalvtgasrgigqaialelgrlgavvigtatsasgaekiaetlkangvegaglv
ldvssdesvaatlehiqqhlgqplivvnnagitrdnllvrmkddewfdvvntnlnslyrl
skavlrgmtkarwgriinigsvvgamgnagqtnyaaakaglegftralarevgsraitvn
avapgfidtdmtrelpeaqreallgqiplgrlgqaeeiakvvgflasdgaayvtgatvpv
nggmyms

SCOPe Domain Coordinates for d4ag3a1:

Click to download the PDB-style file with coordinates for d4ag3a1.
(The format of our PDB-style files is described here.)

Timeline for d4ag3a1: