Lineage for d4adba_ (4adb A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381113Species Escherichia coli [TaxId:511693] [234051] (2 PDB entries)
  8. 1381114Domain d4adba_: 4adb A: [234052]
    automated match to d3nx3a_
    complexed with mg, na, plp

Details for d4adba_

PDB Entry: 4adb (more details), 2.2 Å

PDB Description: Structural and functional study of succinyl-ornithine transaminase from E. coli
PDB Compounds: (A:) succinylornithine transaminase

SCOPe Domain Sequences for d4adba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4adba_ c.67.1.0 (A:) automated matches {Escherichia coli [TaxId: 511693]}
qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs

SCOPe Domain Coordinates for d4adba_:

Click to download the PDB-style file with coordinates for d4adba_.
(The format of our PDB-style files is described here.)

Timeline for d4adba_: