Lineage for d4a63b2 (4a63 B:1056-1121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310427Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1310428Protein automated matches [190457] (7 species)
    not a true protein
  7. 1310459Species Human (Homo sapiens) [TaxId:9606] [187598] (23 PDB entries)
  8. 1310492Domain d4a63b2: 4a63 B:1056-1121 [234035]
    Other proteins in same PDB: d4a63a_, d4a63b1, d4a63c_, d4a63d1, d4a63e_, d4a63f1, d4a63g_, d4a63h1, d4a63i_, d4a63j1, d4a63k_
    automated match to d1ycsb2
    complexed with act, zn

Details for d4a63b2

PDB Entry: 4a63 (more details), 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution
PDB Compounds: (B:) apoptosis stimulating of p53 protein 2

SCOPe Domain Sequences for d4a63b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a63b2 b.34.2.0 (B:1056-1121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg
lyprik

SCOPe Domain Coordinates for d4a63b2:

Click to download the PDB-style file with coordinates for d4a63b2.
(The format of our PDB-style files is described here.)

Timeline for d4a63b2: