Lineage for d4a63b1 (4a63 B:920-1055)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685843Species Human (Homo sapiens) [TaxId:9606] [187689] (7 PDB entries)
  8. 1685853Domain d4a63b1: 4a63 B:920-1055 [234034]
    Other proteins in same PDB: d4a63a_, d4a63b2, d4a63c_, d4a63d2, d4a63e_, d4a63f2, d4a63g_, d4a63h2, d4a63i_, d4a63j2, d4a63k_, d4a63l2
    automated match to d1ycsb1
    complexed with act, zn

Details for d4a63b1

PDB Entry: 4a63 (more details), 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution
PDB Compounds: (B:) apoptosis stimulating of p53 protein 2

SCOPe Domain Sequences for d4a63b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a63b1 d.211.1.1 (B:920-1055) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflv
qfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeeg
ytqcsqflygvqekmg

SCOPe Domain Coordinates for d4a63b1:

Click to download the PDB-style file with coordinates for d4a63b1.
(The format of our PDB-style files is described here.)

Timeline for d4a63b1: