Lineage for d4a61a2 (4a61 A:158-320)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372729Protein automated matches [226905] (10 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [234029] (1 PDB entry)
  8. 1372745Domain d4a61a2: 4a61 A:158-320 [234031]
    automated match to d1mwma2

Details for d4a61a2

PDB Entry: 4a61 (more details), 2 Å

PDB Description: ParM from plasmid R1 in complex with AMPPNP
PDB Compounds: (A:) Plasmid segregation protein parM

SCOPe Domain Sequences for d4a61a2:

Sequence, based on SEQRES records: (download)

>d4a61a2 c.55.1.1 (A:158-320) automated matches {Escherichia coli [TaxId: 562]}
qelderdslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

Sequence, based on observed residues (ATOM records): (download)

>d4a61a2 c.55.1.1 (A:158-320) automated matches {Escherichia coli [TaxId: 562]}
qelderdslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalssyladd
iiihrkdnnylkqrinsivteamnealrkleqrvlntlnefsgythvmvigggaelicda
vkkhtqirderffktnnsqydlvngmylign

SCOPe Domain Coordinates for d4a61a2:

Click to download the PDB-style file with coordinates for d4a61a2.
(The format of our PDB-style files is described here.)

Timeline for d4a61a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a61a1