SCOPe 2.08: Domain d4a61a2: 4a61 A:158-320

Lineage for d4a61a2 (4a61 A:158-320)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [234029] (1 PDB entry)

8. Domain d4a61a2: 4a61 A:158-320 [234031]
   Other proteins in same PDB: d4a61a3
   automated match to d1mwma2
   complexed with anp, mg

Details for d4a61a2

PDB Entry: 4a61, 2 Å

PDB Description: ParM from plasmid R1 in complex with AMPPNP

PDB Compounds: (A:) Plasmid segregation protein parM

SCOPe Domain Sequences for d4a61a2:

Sequence, based on SEQRES records:

>d4a61a2 c.55.1.1 (A:158-320) automated matches {Escherichia coli [TaxId: 562]}
qelderdslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

Sequence, based on observed residues (ATOM records):

>d4a61a2 c.55.1.1 (A:158-320) automated matches {Escherichia coli [TaxId: 562]}
qelderdslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalssyladd
iiihrkdnnylkqrinsivteamnealrkleqrvlntlnefsgythvmvigggaelicda
vkkhtqirderffktnnsqydlvngmylign

Timeline for d4a61a2:

• d4a61a2 first appeared in SCOPe 2.03
  
• d4a61a2 appears in SCOPe 2.07