| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Escherichia coli [TaxId:562] [234029] (1 PDB entry) |
| Domain d4a61a1: 4a61 A:2-157 [234030] Other proteins in same PDB: d4a61a3 automated match to d1mwma1 complexed with anp, mg |
PDB Entry: 4a61 (more details), 2 Å
SCOPe Domain Sequences for d4a61a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a61a1 c.55.1.1 (A:2-157) automated matches {Escherichia coli [TaxId: 562]}
lvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpis
pdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenier
kkanfrkkitlnggdtftikdvkvmpesipagyevl
Timeline for d4a61a1: