Class b: All beta proteins [48724] (110 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (16 proteins) |
Protein Poliovirus [49666] (3 species) |
Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (11 PDB entries) |
Domain d1asj2_: 1asj 2: [23403] |
PDB Entry: 1asj (more details), 2.9 Å
SCOP Domain Sequences for d1asj2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asj2_ b.10.1.4 (2:) Poliovirus {Poliovirus type 1, strain Mahoney} eacgysdrvlqltlgnstittqeaansvvaygrwpeylrdseanpvdqptepdvaacrfy tldtvswtkesrgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgv favpemclagdsntttmhtsyqnanpgekggtftgtftpdnnqtsparrfcpvdyllgng tllgnafvfphqiinlrtnncatlvlpyvnslsidsmvkhnnwgiailplaplnfasess peipitltiapmccefnglrnitlprlq
Timeline for d1asj2_: