Lineage for d1asj1_ (1asj 1:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107303Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 107304Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 107416Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 107515Protein Poliovirus [49666] (3 species)
  7. 107516Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (11 PDB entries)
  8. 107538Domain d1asj1_: 1asj 1: [23402]

Details for d1asj1_

PDB Entry: 1asj (more details), 2.9 Å

PDB Description: p1/mahoney poliovirus, at cryogenic temperature

SCOP Domain Sequences for d1asj1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asj1_ b.10.1.4 (1:) Poliovirus {Poliovirus type 1, strain Mahoney}
aatsrdalpnteasgpthskeipaltavetgatnplvpsdtvqtrhvvqhrsrsessies
ffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrklefftysrfdmeltfvvt
anftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifytygtaparisvpyv
gisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvndhnptkvtskirv
ylkpkhirvwcprppravayygpgvdykdgtltplstkdltty

SCOP Domain Coordinates for d1asj1_:

Click to download the PDB-style file with coordinates for d1asj1_.
(The format of our PDB-style files is described here.)

Timeline for d1asj1_: