SCOPe 2.03: Domain d4a1ig2: 4a1i G:49-164

Lineage for d4a1ig2 (4a1i G:49-164)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family)
   automatically mapped to Pfam PF03734

5. Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
   Pfam PF03734; ErfK/YbiS/YcfS/YnhG

6. Protein automated matches [234004] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [234005] (3 PDB entries)

8. Domain d4a1ig2: 4a1i G:49-164 [234014]
   Other proteins in same PDB: d4a1ia1, d4a1ib1, d4a1ic1, d4a1id1, d4a1ie1, d4a1if1, d4a1ig1, d4a1ih1
   automated match to d1y7ma1
   complexed with cd, cl, so4

Details for d4a1ig2

PDB Entry: 4a1i, 1.76 Å

PDB Description: ykud from B.subtilis

PDB Compounds: (G:) putative l, d-transpeptidase ykud

SCOPe Domain Sequences for d4a1ig2:

Sequence; same for both SEQRES and ATOM records:

>d4a1ig2 b.160.1.1 (G:49-164) automated matches {Bacillus subtilis [TaxId: 1423]}
pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf
gaywlslsaahygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr

Timeline for d4a1ig2:

• d4a1ig2 is new in SCOPe 2.03-stable
  
• d4a1ig2 appears in SCOPe 2.04
  
• d4a1ig2 appears in the current release, SCOPe 2.08