Lineage for d4a1ie2 (4a1i E:49-164)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825385Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2825386Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
    automatically mapped to Pfam PF03734
  5. 2825387Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 2825409Protein automated matches [234004] (6 species)
    not a true protein
  7. 2825410Species Bacillus subtilis [TaxId:1423] [234005] (3 PDB entries)
  8. 2825415Domain d4a1ie2: 4a1i E:49-164 [234013]
    Other proteins in same PDB: d4a1ia1, d4a1ia3, d4a1ib1, d4a1ib3, d4a1ic1, d4a1ic3, d4a1id1, d4a1id3, d4a1ie1, d4a1if1, d4a1ig1, d4a1ih1
    automated match to d1y7ma1
    complexed with cd, cl, so4

Details for d4a1ie2

PDB Entry: 4a1i (more details), 1.76 Å

PDB Description: ykud from B.subtilis
PDB Compounds: (E:) putative l, d-transpeptidase ykud

SCOPe Domain Sequences for d4a1ie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a1ie2 b.160.1.1 (E:49-164) automated matches {Bacillus subtilis [TaxId: 1423]}
pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf
gaywlslsaahygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr

SCOPe Domain Coordinates for d4a1ie2:

Click to download the PDB-style file with coordinates for d4a1ie2.
(The format of our PDB-style files is described here.)

Timeline for d4a1ie2: