| Class b: All beta proteins [48724] (180 folds) |
| Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily) barrel, closed; n=8, S=10; one overside connection |
Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) ![]() automatically mapped to Pfam PF03734 |
| Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins) Pfam PF03734; ErfK/YbiS/YcfS/YnhG |
| Protein automated matches [234004] (6 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [234005] (3 PDB entries) |
| Domain d4a1ie2: 4a1i E:49-164 [234013] Other proteins in same PDB: d4a1ia1, d4a1ia3, d4a1ib1, d4a1ib3, d4a1ic1, d4a1ic3, d4a1id1, d4a1id3, d4a1ie1, d4a1if1, d4a1ig1, d4a1ih1 automated match to d1y7ma1 complexed with cd, cl, so4 |
PDB Entry: 4a1i (more details), 1.76 Å
SCOPe Domain Sequences for d4a1ie2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a1ie2 b.160.1.1 (E:49-164) automated matches {Bacillus subtilis [TaxId: 1423]}
pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf
gaywlslsaahygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr
Timeline for d4a1ie2: