SCOPe 2.08: Domain d3zzea_: 3zze A:

Lineage for d3zzea_ (3zze A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d3zzea_: 3zze A: [233999]
   automated match to d4ap7a_
   complexed with 6xp

Details for d3zzea_

PDB Entry: 3zze, 1.87 Å

PDB Description: crystal structure of c-met kinase domain in complex with n'-((3z)-4- chloro-7-methyl-2-oxo-1,2-dihydro-3h-indol-3-ylidene)-2-(4- hydroxyphenyl)propanohydrazide

PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3zzea_:

Sequence; same for both SEQRES and ATOM records:

>d3zzea_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnritdi
gevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptv
kdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvh
nktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllq
grrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi

Timeline for d3zzea_:

• d3zzea_ first appeared in SCOPe 2.03
  
• d3zzea_ appears in SCOPe 2.07