Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.0: automated matches [191390] (1 protein) not a true family |
Protein automated matches [190500] (7 species) not a true protein |
Species Prochloron didemni [TaxId:1216] [194745] (3 PDB entries) |
Domain d3zxya_: 3zxy A: [233997] automated match to d3zxxa_ mutant |
PDB Entry: 3zxy (more details), 1.58 Å
SCOPe Domain Sequences for d3zxya_:
Sequence, based on SEQRES records: (download)
>d3zxya_ c.41.1.0 (A:) automated matches {Prochloron didemni [TaxId: 1216]} mgslkgdhnirvaildgpvdiahpcfqgadltvlptlaptaarsdgfmsahgthvasiif gqpetsvpgiapqcrglivpifsddrrritqldlargieravnagahiinisggeltdfg eadgwlenavslcrqnnvllvaaagnngcdclhvpaalpavlavgamddhghpldfsnwg styeqqgilapgedilgakpgggterlsgtafatpivsgvaalllseqvrrgetpdpqkv rqlllqsalpcdddapeqarrclagrlnvsgaftllkggdms
>d3zxya_ c.41.1.0 (A:) automated matches {Prochloron didemni [TaxId: 1216]} mgslkgdhnirvaildgpvdiahpcfqgadltvlptlaptaarsdgfmsahgthvasiif gqpetsvpgiapqcrglivpifsddrrritqldlargieravnagahiinisggeltdfg eadgwlenavslcrqnnvllvaaagnngcdclhvpaalpavlavgamddhghpldfsnwg styeqqgilapgedilgakpgggterlsgtafatpivsgvaalllseqvrrgetpdpqkv rqlllqsalpcarrclagrlnvsgaftllkggdms
Timeline for d3zxya_: