Lineage for d3zpbe_ (3zpb E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531574Protein automated matches [190291] (23 species)
    not a true protein
  7. 1531625Species Influenza A virus [TaxId:11320] [187142] (16 PDB entries)
  8. 1531643Domain d3zpbe_: 3zpb E: [233993]
    Other proteins in same PDB: d3zpbf_
    automated match to d3zp6e_
    complexed with nag; mutant

Details for d3zpbe_

PDB Entry: 3zpb (more details), 2.6 Å

PDB Description: influenza virus (vn1194) h5 e190d mutant ha with lsta
PDB Compounds: (E:) Haemagglutinin

SCOPe Domain Sequences for d3zpbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zpbe_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaadqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3zpbe_:

Click to download the PDB-style file with coordinates for d3zpbe_.
(The format of our PDB-style files is described here.)

Timeline for d3zpbe_: