Lineage for d3wkml1 (3wkm L:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760215Domain d3wkml1: 3wkm L:1-111 [233981]
    Other proteins in same PDB: d3wkmh_, d3wkmi_
    automated match to d3wkmm1

Details for d3wkml1

PDB Entry: 3wkm (more details), 2.2 Å

PDB Description: The periplasmic PDZ tandem fragment of the RseP homologue from Aquifex aeolicus in complex with the Fab fragment
PDB Compounds: (L:) mouse igg1-kappa fab (light chain)

SCOPe Domain Sequences for d3wkml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wkml1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
yivltqspvslavslgqratiscrasesvdsygdsfmhwyqqkpgqppklliylasnles
gvparfsgsgsrtdftltidpveaddaatyycqqnnedpwtfgggtkleik

SCOPe Domain Coordinates for d3wkml1:

Click to download the PDB-style file with coordinates for d3wkml1.
(The format of our PDB-style files is described here.)

Timeline for d3wkml1: