Lineage for d3wkha_ (3wkh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722365Species Rhodothermus marinus [TaxId:29549] [230219] (4 PDB entries)
  8. 2722367Domain d3wkha_: 3wkh A: [233978]
    automated match to d3wkga_
    complexed with cl, po4

Details for d3wkha_

PDB Entry: 3wkh (more details), 1.64 Å

PDB Description: crystal structure of cellobiose 2-epimerase in complex with epilactose
PDB Compounds: (A:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d3wkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wkha_ a.102.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
tetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprgai
lnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtrkh
vyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrpleda
rlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghlil
ffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegrapd
gslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrdtr
ggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehvrsr

SCOPe Domain Coordinates for d3wkha_:

Click to download the PDB-style file with coordinates for d3wkha_.
(The format of our PDB-style files is described here.)

Timeline for d3wkha_: