SCOPe 2.06: Domain d3wkfa_: 3wkf A:

Lineage for d3wkfa_ (3wkf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (16 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [230219] (4 PDB entries)

8. Domain d3wkfa_: 3wkf A: [233976]
   automated match to d3wkga_
   complexed with cl, po4

Details for d3wkfa_

PDB Entry: 3wkf, 1.74 Å

PDB Description: Crystal structure of cellobiose 2-epimerase

PDB Compounds: (A:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d3wkfa_:

Sequence; same for both SEQRES and ATOM records:

>d3wkfa_ a.102.1.0 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
tetipdvrrlralqaevheeltenilkfwatrthdpvhggfvgrvgpdgrphpeaprgai
lnarilwtfaaayrqlgtplyremaerayryfvrhfvdaehggvywmvaadgrpldtrkh
vyaqsfaiyalsewhratggeaalalarsiydliethcadrvhggyveacdrawrpleda
rlsakdapeprsmnthlhvleayanlyrvwpetelaarlqalielflraiyhpatghlil
ffderwrprsravsfghdieaswllleavdvlgqatlrprvqqaslhlaratlaegrapd
gslyyeigeqghldtdrhwwpqaealvgflnayqesgevlfyeaaedvwryirerqrdtr
ggewfarvrddgapypddkvdfwkgpyhngracleaiqrlrhllehv

Timeline for d3wkfa_:

• d3wkfa_ first appeared in SCOPe 2.03
  
• d3wkfa_ appears in SCOPe 2.05
  
• d3wkfa_ appears in SCOPe 2.07
  
• d3wkfa_ appears in the current release, SCOPe 2.08