SCOPe 2.08: Domain d3wjjc2: 3wjj C:86-168

Lineage for d3wjjc2 (3wjj C:86-168)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d3wjjc2: 3wjj C:86-168 [233975]
   Other proteins in same PDB: d3wjja1, d3wjja2, d3wjjb1, d3wjjb2
   automated match to d3wjlc2

Details for d3wjjc2

PDB Entry: 3wjj, 2.6 Å

PDB Description: crystal structure of iib selective fc variant, fc(p238d), in complex with fcgriib

PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor II-b

SCOPe Domain Sequences for d3wjjc2:

Sequence; same for both SEQRES and ATOM records:

>d3wjjc2 b.1.1.4 (C:86-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewlvlqtphlefqegetivlrchswkdkplvkvtffqngkskkfsrsdpnfsipqanhsh
sgdyhctgnigytlysskpvtit

Timeline for d3wjjc2:

• d3wjjc2 first appeared in SCOPe 2.03
  
• d3wjjc2 appears in SCOPe 2.07