Lineage for d3wg4b_ (3wg4 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781847Species Agrocybe cylindracea [TaxId:64608] [225007] (6 PDB entries)
  8. 1781851Domain d3wg4b_: 3wg4 B: [233959]
    automated match to d3wg4a_
    complexed with peg; mutant

Details for d3wg4b_

PDB Entry: 3wg4 (more details), 1.6 Å

PDB Description: crystal structure of agrocybe cylindracea galectin mutant (n46a) with blood type a antigen tetraose
PDB Compounds: (B:) Galactoside-binding lectin

SCOPe Domain Sequences for d3wg4b_:

Sequence, based on SEQRES records: (download)

>d3wg4b_ b.29.1.0 (B:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
hmttsavniynisagasvdlaapvttgdivtffssalnlsagagspantalnllsengay
llhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvin
ektviqytkqisgttsslsynstegtsifstvveavtytgla

Sequence, based on observed residues (ATOM records): (download)

>d3wg4b_ b.29.1.0 (B:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
hmttsavniynisagasvdlaapvttgdivtffssalnlpantalnllsengayllhiaf
rlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviq
ytkqisgttsslsynsttsifstvveavtytgla

SCOPe Domain Coordinates for d3wg4b_:

Click to download the PDB-style file with coordinates for d3wg4b_.
(The format of our PDB-style files is described here.)

Timeline for d3wg4b_: