Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries) |
Domain d3wg3b1: 3wg3 B:0-160 [233958] Other proteins in same PDB: d3wg3a2, d3wg3a3, d3wg3b2 automated match to d3wg3a_ complexed with a2g, edo, fuc, gal, nag, peg |
PDB Entry: 3wg3 (more details), 1.35 Å
SCOPe Domain Sequences for d3wg3b1:
Sequence, based on SEQRES records: (download)
>d3wg3b1 b.29.1.0 (B:0-160) automated matches {Agrocybe cylindracea [TaxId: 64608]} hmttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengay llhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvin ektviqytkqisgttsslsynstegtsifstvveavtytgl
>d3wg3b1 b.29.1.0 (B:0-160) automated matches {Agrocybe cylindracea [TaxId: 64608]} hmttsavniynisagasvdlaapvttgdivtffssalnlpnntalnllsengayllhiaf rlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviq ytkqisgttsslsynstgtsifstvveavtytgl
Timeline for d3wg3b1: